PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn156881
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 222aa    MW: 25643.4 Da    PI: 7.7634
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn156881genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.51.5e-2882131251
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                 prlrWtp+LH++Fv+a+e+LGG+ekAtPk il+lm+vkgL ++hvkSHLQ
  Achn156881  82 PRLRWTPDLHHSFVRAIERLGGQEKATPKLILQLMDVKGLGIAHVKSHLQ 131
                 8************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-2678131IPR009057Homeodomain-like
SuperFamilySSF466894.66E-1280135IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-1982131IPR006447Myb domain, plants
PfamPF002492.0E-583131IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MSEGMDIQDD KKSETNEEHL KNTSSSVSSQ KLSSFDLNEE ANNGEDSDCN KEDDLGNNNS  60
TISREGNERK AITRQYVRSK MPRLRWTPDL HHSFVRAIER LGGQEKATPK LILQLMDVKG  120
LGIAHVKSHL QPSNWNYRNN TTRIWQFQSY LQDTKTVSNT LERKFNSPFS FQEKRLKREE  180
RLPDLKLRLS ENFENNEERP TYGKNMQEIN TVLSLSLSPH S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148039.15e-43hypothetical protein PHAVU_006G175300g
RefseqXP_007148040.15e-43hypothetical protein PHAVU_006G175300g
TrEMBLA0A0S3S2Y94e-43A0A0S3S2Y9_PHAAN; Uncharacterized protein
TrEMBLA0A151S6I74e-43A0A151S6I7_CAJCA; Putative Myb family transcription factor At1g14600 family
STRINGGLYMA08G12320.22e-41(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-30G2-like family protein